![]() |
|
If you can't view the Datasheet, Please click here to try to view without PDF Reader . |
|
Datasheet File OCR Text: |
v-series P5G43 asus pc (desktop barebo ne) installation manual r r http://
ii copyright ? 2008 asust ek computer inc. all rights reserved. no part of this manual, including the products and software described in it, may be reproduced, transmitted, transcribed, stored in a retrieval system, or translated into any language in any for m or by any means, except documentation kept by the purchaser for backup purposes, without the expre ss written permission of asust ek computer inc. (asus). product warranty or service will not be extended if: (1) the product is repaired, modifed or alt ered, unless such repair , modifcation of alteration is authorized in writing by asus; or (2) the serial number of the product is defaced or missing. asus provides this manual as is without w arranty of any kind, either e xpress or implied, including but not limited t o the implied w arranties or conditions of merchant ability or fitness for a p ar ticular purpose. in no event shall asus, it s direct ors, officers, employees or agents be liable for any indirect , special, incident al, or consequential damages (including damages for loss of p rofits, loss of business, loss of use or da t a, interruption of business and the like), even if asus has been advised of the possibility of such damages arising f rom any defect or error in this manual or product . specifica tions and informa tion cont ained in this manual are furnished for informa tional use onl y , and are subject t o change a t any time without notice, and should not be construed as a commitment by asus. asus assumes no responsibility or liability for any errors or inaccuracies tha t ma y appear in this manual, including the products and softw are described in it . products and corporate names appearing in this manual may or may not be registered trademarks or copyrights of their respective companies, and are used only for identifcation or explanation a nd to the owners beneft, without intent to infringe. e4143 first edition v1 november 2008 iii table of contents notices . ......................................................................................................... v i safety . information . ..................................................................................... vii about . this . guide . ....................................................................................... vii i system . package . contents . ........................................................................... x chapter . 1: . system . introductio n 1.1 . w elcome! . ...................................................................................... 1- 2 1.2 . front . panel . .................................................................................... 1- 2 1.3 . rear . panel . ..................................................................................... 1- 4 v oltage selector .............................................................................. 1- 7 1.4 . internal . components . .................................................................... 1- 8 chapter . 2: . basic . installatio n 2.1 . preparation . ................................................................................... 2- 2 2.2 . before . you . proceed . ..................................................................... 2- 2 2.3 . removing . the . side . cover . and . front . panel . assembly . ................ 2- 3 2.4 . central . processing . unit . (cpu) . ................................................... 2- 4 2.4.1 overview ......................................................................... 2- 4 2.4.2 installing cpu ................................................................. 2- 4 2.4.3 installing the cpu fan and heatsink assembly ................ 2- 6 2.5 . installing . a . dimm . .......................................................................... 2- 8 0hprufrqjxudwlrqv .................................................... 2- 9 2.5.2 installing a ddr2 dimm ............................................... 2-1 5 2.5.3 removing a ddr2 dimm ............................................. 2-1 5 2.6 . expansion . slots . .......................................................................... 2-1 6 2.6.1 installing an expansion card ......................................... 2-1 6 &rqjxulqjdqhsdqvlrqfdug ..................................... 2-1 6 2.6.3 pci slots ........................................................................ 2-1 8 2.6.4 pci express x1 slot ....................................................... 2-1 8 2.6.5 pci express x16 slot ..................................................... 2-1 8 2.7 . installing . an . optical . drive . .......................................................... 2-1 9 2.8 . installing . a . hard . disk . drive . ........................................................ 2-2 0 2.9 . installing . the . card . reader . .......................................................... 2-2 2 2.10 installing a foppy disk drive . ..................................................... 2-2 4 2.1 1 . re-connecting . cables . ................................................................ 2-2 5 led cables ................................................................................... 2-2 5 iv table of contents 2.12 . reinstalling . the . cover . ............................................................... -2-2 6 chapter . 3: . starting . u p 3.1 . installing . an . operating . system . ................................................... 3- 2 3.2 . powering . up . .................................................................................. 3- 2 3.3 . support . dvd . information . ............................................................ 3- 2 3.3.1 running the support dvd ............................................... 3- 3 3.3.2 utilities menu .................................................................. 3- 4 3.3.3 manual menu .................................................................. 3- 6 3.3.4 asus contact information .............................................. 3- 7 3.3.5 other information ............................................................ 3- 8 3.4 . software . information . ................................................................. 3-1 0 asus pc probe ii ........................................................................ 3-1 0 chapter . 4: . motherboard . i n formation 4.1 . introduction . .................................................................................. 4- 2 4.2 . motherboard . layout . ...................................................................... 4- 2 4.3 . jumpers . ........................................................................................ 4- 3 4.3 . connectors . ................................................................................... 4- 5 chapter . 5: . bios . setup 5.1 . managing . and . updating . your . bios . ............................................ 5- 2 5.1.1 asus update utility ........................................................ 5- 2 &uhdwlqjderrwdeohrssglvn ....................................... 5- 5 5.1.3 asus ez flash 2 utility ................................................... 5- 6 5.1.4 afudos utility ................................................................ 5- 7 5.1.5 asus crashfree bios 3 utility ...................................... 5- 9 5.2 . bios . setup . program . .................................................................. 5-1 0 5.2.1 bios menu screen ......................................................... 5-1 1 5.2.2 menu bar ........................................................................ 5-1 1 5.2.3 navigation keys .............................................................. 5-1 1 5.2.4 menu items ................................................................... 5-1 2 5.2.5 sub-menu items ............................................................ 5-1 2 &rqjxudwlrqhogv ....................................................... 5-1 2 5.2.7 pop-up window ............................................................. 5-1 2 5.2.8 scroll bar ....................................................................... 5-1 2 v table of contents 5.2.9 general help ................................................................. 5-1 2 5.3 . main . menu . .................................................................................. 5-1 3 5.3.1 system time ................................................................. 5-1 3 5.3.2 system date ................................................................. 5-1 3 5.3.3 legacy diskette a ......................................................... 5-1 3 5.3.4 sata 1~6 ...................................................................... 5-1 4 6wrudjh&rqjxudwlrq ................................................... 5-1 5 5.3.6 system information ....................................................... 5-1 6 5.4 . advanced . menu . ......................................................................... 5-1 7 -xpshuiuhh&rqjxudwlrq ............................................. 5-1 7 &38&rqjxudwlrq ........................................................ 5-1 9 5.4.3 chipset .......................................................................... 5-2 1 2qerdug'hylfhv&rqjxudwlrq .................................... 5-2 3 86&rqjxudwlrq ........................................................ 5-2 5 5.4.6 pci pnp ........................................................................ 5-2 6 5.5 . power . menu . ................................................................................ 5-2 7 5.5.1 suspend mode .............................................................. 5-2 7 5.5.2 acpi 2.0 support .......................................................... 5-2 7 5.5.3 acpi apic support ....................................................... 5-2 7 30&rqjxudwlrq ........................................................ 5-2 8 5.5.5 hardware monitor ......................................................... 5-2 9 5.6 . boot . menu . .................................................................................. 5-3 0 5.6.1 boot device priority ...................................................... 5-3 0 rrw6hwwlqjv&rqjxudwlrq .......................................... 5-3 1 5.6.3 security ......................................................................... 5-3 2 5.7 . tools . menu . ................................................................................. 5-3 4 5.7.1 asus ez flash 2 .......................................................... 5-3 4 5.7.2 express gate ................................................................ 5-3 5 5.7.3 ai net 2 ........................................................................ 5-3 6 5.8 . exit . menu . .................................................................................... 5-3 7 vi notices federal . communications . commission . statement this device complies with part 15 of the fcc rules. operation is subject to the following two conditions: ? this device may not cause harmful interference, and ? this device must accept any interference received including interference that may cause undesired operation. this equipment has been tested and found to comply with the limits for a class b digital device, pursuant to part 15 of the fcc rules. these limits are designed to provide reasonable protection against harmful interference i n a residential installation. this equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with manu facturers instructions, may cause harmful interference to radio communications. ho wever , there is no guarantee that interference will not occur in a particular insta llation. if this equipment does cause harmful interference to radio or television rece ption, which can be determined by turning the equipment of f and on, the user is encouraged to try to correct the interference by one or more of the followin g measures: ? reorient or relocate the receiving antenna. ? increase the separation between the equipment and receiver . ? connect the equipment to an outlet on a circuit dif ferent from that to which the receiver is connected. ? consult the dealer or an experienced radio/tv technician for help. canadian . department . of . communications . statement this digital apparatus does not exceed the class b limits for radio noise e missions from digital apparatus set out in the radio interference regulations of the canadian department of communications. this class b digital apparatus complies with canadian ices-003 . warning! . the use of shielded cables for connection of the monitor to the graphics card is required to assure compliance with fcc regulations. changes ruprglfdwlrqvwrwklvxqlwqrwhsuhvvodssuryhgewkhsduwuhvsrqvleohiru compliance could void the users authority to operate this equipment. vii safety information electrical . safety ? 7 rsuhyhqwhohfwulfdovkrfnkddugglvfrqqhfwwkhsrzhufdeohiurpwkh electrical outlet before relocating the system. ? when adding or removing devices to or from the system, ensure that the power cables for the devices are unplugged before the signal cables are connec ted. ? ,iwkhsrzhuvxssolveurnhqgrqrwwuwrlwerxuvhoi&rqwdfwdtxd olhg service technician or your retailer . operation . safety ? before installing devices into the system, carefully read all the documenta tion that came with the package. ? before using the product, make sure all cables are correctly connected an d the power cables are not damaged. if you detect any damage, contact your d ealer immediately . ? t o avoid short circuits, keep paper clips, screws, and staples away from connectors, slots, sockets and circuitry . ? avoid dust, humidity, and temperature extremes. do not place the product in any area where it may become wet. place the product on a stable surface. ? ,irxhqfrxqwhuwhfkqlfdosureohpvzlwkwkhsurgxfwfrqwdfwdtxdolhg service technician or your retailer. lithium-ion battery w arning caution : danger of explosion if battery is incorrectly replaced. replace only with the same or equivalent type recommended by the manufacturer . dispose of used batteries according to the manufacturers instructions. vorsicht : explosionsgetahr bei unsachgem??en austausch der batterie. (uvdwqxugxufkghqvhoehqrghuhlqhpyrp+huvwhoohuhpsirkohqhp ?hnljchen t yp. entsorgung gebrauchter batterien nach angaben des herstellers. laser product warning class . 1 . laser . product viii about this guide audience this guide provides general information and installation instructions abo ut the asus v intage v -series P5G43 barebone system. this guide is intend ed for experienced users and integrators with hardware knowledge of person al computers. how . this . guide . is . organized this guide contains the following parts: 1. . chapter . 1: . system . introduction this chapter gives a general description of the asus v -series P5G43. the chapter lists the system features, including introdu ction on the front and rear panel, and internal components. 2. . chapter . 2: . basic . installation this chapter provides step-by-step instructions on how to install compone nts in the system. 3. . chapter . 3: . starting . up this chapter helps you power up the system and install drivers and utilitie s from the support dvd. 4. . chapter . 4: . motherboard . information this chapter gives information about the motherboard that comes with the system. this chapter includes the motherboard layout, jumper settings, a nd connector locations. 5. . chapter . 5: . bios . setup this chapter tells you how to change system settings through the bios setup menus and describes the bios parameters. ix conventions . used . in . this . guide w arning : information to prevent injury to yourself when trying to complete a task. caution: information to prevent damage to the components when trying to complete a task. impor t ant : instructions that you must follow to complete a task. note : tips and additional information to aid in completing a task. where to fnd more information refer to the following sources for additional information and for product and software updates. 1. . asus . w ebsites the asus websites worldwide provide updated information on asus hardware and software products. refer to the asus contact information. 2. . optional . documentation y our product package may include optional documentation, such as warra nty huvwkdwpdkdyhehhqdgghgerxughdohu 7khvhgrfxphqwvduh qrw part of the standard package. x system package contents check your v-series P5G43 system package for the following items. if any of the items is damaged or missing, contact your retailer immediately. item . description 1. asus v-series P5G43 barebone system with ? asus motherboatd ? power supply unit ? asus chassis 2. cable ? ac power cable 3. support dvd 4. user guide 5. telecom adapter card (optional) r r system introduction this chapter gives you a general description of the asus v -series P5G43. the chapter lists the system features including introduction on the front and rear panel, and internal components. chapter 1 1-2 chapter 1: system introduction 1.1 welcome! thank you for buying the asus v -series P5G43! the asus v -series P5G43 is an all-in-one barebone system with a vers atile home entertainment feature. the system comes in a stylish casing and powered by the asus motherboard that supports the intel ? core? 2 extreme / core?2 duo / core?2 quad / pentium ? d / pentium ? 4 / celeron ? d processors in the 775-land package. the system supports up to 8 gb of system memory using ddr2-1066/80 0/667 dimms. high-resolution graphics via integrated graphics controller or pc i express x16 slot, serial a t a, usb 2.0, and 8-channel audio feature the system and take you ahead in the world of power computing. 1.2 front panel the front panel includes the optical drive bays, foppy disk drive slot, powe r button, and several i/o ports are located at the front panel. r 3 7 8 6 5 4 1 2 9 9 1-3 asus v-series P5G43 1. t wo empty 5.25-inch bays. these bays are for ide optical drives. 2. 3.5-inch drive bays . these slots are for 3.5-inch foppy or hard disk drives. 3. power button. press this button to turn the system on. 4. reset button. press this button to reboot the system without turning of f the power . 5. hdd led. this led lights up when data is read from or written to the hard disk drive. 6. usb 2.0 ports. these universal serial bus 2.0 (usb 2.0) ports are available for connecting usb 2.0 devices such as a mouse, printer , scanner , camera, pda, and others. 7. headphone port. this line in (green) port connects a headphone with a stereo mini-plug. 8. microphone port. this mic (pink) port connects a microphone. 9. ieee1394 port. this v-series provide v2/v3 two types of front panel for users to choose, please refer to your product package for the front panel type you purchased. 1-4 chapter 1: system introduction 1.3 rear panel the system rear panel includes the power connector and several i/o ports that allow convenient connection of devices. 1. . ps/2 . keyboard . port . (purple) . this port is for a ps/2 keyboard. 2. . vga . por t. this port is for a vga monitor or other vga-compatible devices. 3. . usb . 2.0 . ports. these two 4-pin universal serial bus (usb) ports are available for connecting usb 2.0 devices. 4. . lan . (rj-45) . port. supported by gigabit lan controller, this port allows gigabit connection to a local area network (lan) through a network hub. refer to the table below for the lan port led indications. 1394 sata hdmi dvi 1 12 2 13 11 18 5 10 9 8 7 16 14 17 3 4 6 15 1-5 asus v-series P5G43 activity . led link . speed . led status description status description off no link off 10 mbps connection orange linked orange 100 mbps connection blinking data activity green 1 gbps connection lan . port . led . indications speed . led act/link . led lan . port 5. .. rear . speaker . out . port . (black). this port connects the rear speakers in a 4-channel, 6-channel, or 8-channel audio confguration. 6. . center/subwoofer . port . (orange). this port connects the center/subwoofer speakers. 7. . line . in . port . (light . blue). this port connects the tape, cd, dvd player , or other audio sources. 8. . line . out . port . (lime). this port connects a headphone or a speaker . in 4-channel, 6-channel, and 8-channel confguration, the function of this po rt becomes front speaker out. 9. . microphone . port . (pink). this port connects a microphone. 10. . side . speaker . out . port . (gray). this port connects the side speakers in an 8-channel audio confguration. 11. . external . sata . port. . this port connects to an external serial ata hard disk drive. audio 2, 4, 6, or 8-channel confguration port headset . 2-channel 4-channel 6-channel 8-channel light blue line in line in line in line in lime line out front speaker out front speaker out front speaker out pink mic in mic in mic in mic in orange C C center/subwoofer center/subwoofer black C rear speaker out rear speaker ou rear speaker out gray C C C side speaker out refer to the audio confguration table below for the function of the audio ports in 2, 4, 6, or 8-channel confguration. do not insert different connectors to the external sata port. 12. . usb . 2.0 . ports. these two 4-pin universal serial bus (usb) ports are available for connecting usb 2.0 devices. 13. . dvi . port. . this port is for any dvi-d compatible device. dvi-d cant be converted to output rgb signal to crt and isnt compatible with dvi-i. 1-6 chapter 1: system introduction 14. . hdmi . port. . this port is for a high-defnition multimedia interface (hdmi) connector , and is hdcp compliant allowing playback of hd dvd, blu-r ay and other protected content. 15. . expansion . slot . covers. remove these covers when installing expansion cards. 16. . power . supply . unit . fan . vent. . this vent is for the psu fan that provides ventilation inside the power supply unit. 17. . ieee1394a . port. . this 6-pin ieee 1394a port provides high-speed connectivity for audio/video devices, storage peripherals, pcs, or portab le devices. 18. . usb . 2.0 . ports. these two 4-pin universal serial bus (usb) ports are available for connecting usb 2.0 devices. 1-7 asus v-series P5G43 voltage . selector the psu has a 1 15 v/230 v voltage selector switch located beside the p ower connector . use this switch to select the appropriate system input voltage a ccording to the voltage supply in your area. if the voltage supply in your area is 100 - 127 v , set this switch to 1 15 v . if the voltage supply in your area is 200 - 240 v, set this switch to 230 v. setting the switch to 115v in a 230v environment or 230v in a 115v environment will seriously damage the system! 115v/230v voltage . selector 1-8 chapter 1: system introduction 1.4 internal components the illustration below is the internal view of the system when you remov e the top cover and the power supply unit. the installed components are labeled fo r your reference. proceed to chapter 2 for instructions on installing additional s ystem components. 1. front panel cover 2. 5.25-inch optical drive bays 3. floppy disk drive bay 4. hard disk drive bay 5. power supply unit 6. cpu socket 7. dimm sockets 8. asus motherboard 9. pci express x16 slot 10. pci express x1 slot 11. pci slot 12. metal bracket lock p5ql-em r 2 1 3 5 4 9 6 7 12 8 10 11 this chapter provides step-by-step instructions on how to install components in the system. chapter 2 basic installation r r 2-2 chapter 2: basic installation 2.1 preparation before you proceed, make sure that you have all the components you p lan to install in the system. basic . components . to . install 1. central processing unit (cpu) 2. ddr2 dual inline memory module (dimm) 3. expansion card(s) 4. hard disk drive 5. optical drive 6. floppy disk drive t ool phillips (cross) screw driver the motherboard comes with an onboard standby power led. this led lights up to indicate that the system is on, in sleep mode or in soft-off mode, and not powered off. unplug the power cable from the power outlet and make sure that the standby power led is off before installing any system component. ? use a grounded wrist strap or touch a safely grounded object or a metal object, such as the power supply case, before handling components to avoid damaging them due to static electricity . ? hold components by the edges to avoid touching the ics on them. ? whenever you uninstall any component, place it on a grounded antistatic pad or in the bag that came with the component. 2.2 before you proceed take note of the following precautions before you install components into the system. p5ql-em.onboard.led p5ql-em r sb_pw r on standby powe r of f powered of f 2-3 asus v-series P5G43 2.3 removing the side cover and front panel assembly 1. remove the cover screws on the rear panel. 2. pull the side cover toward the rear panel until its hooks disengage from the chassis tab holes. set the side cover aside. 3. locate the front panel assembly hooks, then lift them until they dise ngage from the chassis. 4. swing the front panel assembly to the right, until the hinge-like tabs on the right side of the assembly are exposed. 5. remove the front panel assembly, then set aside. 1 1 2 2 4 3 4 4 3 3 chassis . tab . holes air . duct 4 2-4 chapter 2: basic installation 2.4 central processing unit (cpu) 2.4.1 . overview 2.4.2 . installing . cpu t o install a cpu: 1. locate the cpu socket on the motherboard. before installing the cpu, make sure that the socket box is facing towards you and the load lever is on your left. the motherboard comes with a surface mount lga775 socket designed fo r the intel ? core ? 2 quad / intel ? core ? 2 extreme / core ? 2 duo / pentium ? extreme / pentium ? d/ pentium ? 4 / celeon ? processors. ? upon purchase of the motherboard, make sure that the pnp cap is on the socket and the socket contacts are not bent. contact your retailer immediately if the pnp cap is missing, or if you see any damage to the pnp cap/socket contacts/motherboard components. asus will shoulder the cost of repair only if the damage is shipment/transit-related. ? keep the cap after installing the motherboard. asus will process return merchandise authorization (rma) requests only if the motherboard comes with the cap on the lga775 socket. ? the product warranty does not cover damage to the socket contacts resulting from incorrect cpu installation/removal, or misplacement/loss/ incorrect removal of the pnp cap. ? make sure that all power cables are unplugged before installing the cpu. ? connect the chassis fan cable to the cha_fan1 connector to ensure system stability. p5ql-em. cpu.socket.775 p5ql-em r 2-5 asus v-series P5G43 to prevent damage to the socket pins, do not remove the pnp cap unless you are installing a cpu. 2. press the load lever with your thumb (a), then move it to the left (b) until it is released from the retention tab. 3. lift the load lever in the direction of the arrow to a 135o angle. a b load . lever retention . tab 4. lift the load plate with your thumb and forefnger to a 100o angle (4a), then push the pnp cap from the load plate window to remove (4b). 5. position the cpu over the socket, making sure that the gold triangle is on the bottom - left corner of the socket then ft the socket alignment key into the cpu notch. gold . triangle . mark alignment . key cpu . notch load . plate pnp . cap 4a 4b 3 2-6 chapter 2: basic installation 7. close the load plate (a), then push the load lever (b) until it snaps into the retention tab. 6. apply thermal interface material on the cpu before closing the load plate. a b do . not eat the thermal interface material. if it gets into your eyes or touches your skin, make sure to wash it of f immediately , and seek professional medical help. 2.4.3 . installing . the . cpu . fan . and . heatsink . assembly the intel ? pentium ? 4 lga775 processor requires a specially designed heatsink and fan assembly to ensure optimum thermal condition and performance. ? when you buy a boxed intel ? pentium ? 4 processor , the package includes the cpu fan and heatsink assembly. if you buy a cpu separately, make sure that you use only intel ? - certifed multi - directional heatsink and fan. ? your intel ? pentium ? 4 lga775 heatsink and fan assembly comes in a push-pin design and requires no tool to install. 2-7 asus v-series P5G43 if you purchased a separate cpu heatsink and fan assembly, make sure that the thermal interface material is properly applied to the cpu heatsink or cpu before you install the heatsink and fan assembly. t o install the cpu heatsink and fan: 1. place the heatsink on top of the installed cpu, making sure that the four fasteners match the holes on the motherboard. 3. when the fan and heatsink assembly is in place, connect the cpu fan cable to the connector on the motherboard. a b b 2. push down two fasteners at a time in a diagonal sequence to secure the heatsink and fan assembly in place. do not forget to connect the cpu fan connector! hardware monitoring errors can occur if you fail to plug this connector. a a b b 1 1 a p5ql-em.cpu. fan.connector p5ql-em r cpu_ f a n gnd cpu fa n pw r cpu fa n in cpu fa n pw m 2-8 chapter 2: basic installation 2.5 installing a dimm channel sockets channel a dimm_a1 and dimm_a2 channel b dimm_b1 and dimm_b2 the motherboard comes with four double data rate 2 (ddr2) dual inlin e memory modules (dimm) sockets. the fgure illustrates the location of the ddr2 dimm sockets: p5ql-em. 240-pin.ddr2.dimm.socket s p5ql-em r 128 pins 11 2 pins dimm_a2 dimm_b1 dimm_b2 dimm_a1 ? this chipset offcially supports ddr2-800 mhz. with the asus super memspeed technology, this motherboard natively supports up to ddr2-1066 mhz. see the table below. fsb ddr2 1333 1066* 1333 800 1333 667 1066 1066* 1066 800 1066 667 ? *if you install a ddr2-1066 memory module whose spd is ddr2-800, make sure that you set the dram . frequency item in bios to [ddr2-1066mhz]. see section 5.4.1 jumperfree confguration for details. 2-9 asus v-series P5G43 2.5.1 memory confgurations ? y o u m a y i n s t a l l v a r y i n g m e m o r y s i z e s i n c h a n n e l a a n d c h a n n e l b . t h e system maps the total size of the lower-sized channel for the dual-channel c o n f g u r a t i o n . a n y e x c e s s m e m o r y f r o m t h e h i g h e r - s i z e d c h a n n e l i s t h e n mapped for single-channel operation. ? a l w a y s i n s t a l l d i m m s w i t h t h e s a m e c a s l a t e n c y . f o r o p t i m u m c o m p a t i b i l i t y , we recommend that you obtain memory modules from the same vendor . ? due to the memory address limitation on 32-bit windows os, when you install 4gb or more memory on the motherboard, the actual usable memory for the os can be about 3gb or less. for effective use of memory, we recommend that you install a 64-bit windows os when having 4gb or more memory installed on the motherboard. 64-bit windows ? xp professional x64 edition windows ? vista x64 edition notes . on . memory . limitations ? due to chipset limitation, this motherboard can only support up to 8 gb on the operating systems listed below . y ou may install a maximum of 2 gb dimms on each slot. you may install 256 mb, 512 mb, 1 gb, and 2 gb unbuffered non - ecc ddr2 dimms into the dimm sockets. recommended memory confgurations mode dimm_a1 dimm_a2 dimm_b1 dimm_b2 one dimm ds/ss - - - - ds/ss - - - - ds/ss - - - - ds/ss t wo dimms ds/ss - ds/ss - ds/ss - - ds/ss - ds/ss ds/ss - - ds/ss - ds/ss three dimms ss ss ds/ss - ss ss - ds/ss ds/ss - ss ss - ds/ss ss ss four dimms ss ss ss ss 2-10 chapter 2: basic installation p5ql-em motherboard qualifed vendors lists (qvl) . ddr2-1066 . mhz . capability ? some old-version ddr2-800/667 dimms may not match intel ? s on - die - t ermination (odt) requirement and will automatically downgrade to run at ddr2-533. if this happens, contact your memory vendor to check the odt value. ? due to chipset limitation, ddr2-800 with cl=4 will be downgraded to run at ddr2-667 by default setting. if you want to operate with lower latency , adjust the memory timing manually . ? due to chipset limitation, ddr2-667 with cl=3 will be downgraded to run at ddr2-533 by default setting. if you want to operate with lower latency, adjust the memory timing manually. size vendor part . no. cl chip . brand s s / ds . chip . no. dimm . ?upport a* b* 512mb kingston khx8500d2/512 n/a kingston ss heat-sink package ? ? 512mb kingston kvr1066d2n7/512 n/a elpida ss e5108ajbg-1j-e ? ? 512mb kingston khx8500d2k2/1gn n/a kingston ss heat-sink package ? ? 1g kingston kvr1066d2n7/1g n/a elpida ds e5108ajbg-1j-e ? 1g kingston khx8500d2/1g n/a kingston ds heat-sink package ? ? 1g qimonda hys64t128020eu- 19f-c 6 qimonda ds hyb18t512800cf19ff ss24313 ? ? 1g kingmax kled48f-a8k15 n/a kingmax ds kka8ffixf-jfs-18a ? ? 1g corsair cm2x1024-8500c5 n/a corsair ds heat-sink package ? ? 1g geil gb24gb8500c5qc 5 geil ss gl2l128m88ba25ab ? ? 1g geil ge22gb1066c5dc 5 geil ds heat-sink package ? 4g(kit of 2) geil gx24gb8500c5udc 5 n/a ds heat-sink package ? ? 2g(kit of 2) g.skill f2-8500cl5d-2gbpk 5-5-5-15 n/a ds heat-sink package ? ? 4g(kit of 2) g.skill f2-8500cl5d-4gbpk 5-5-5-15 n/a ds heat-sink package ? 1g g.skill f2-8500cl5s-1gbpk 5-5-5-15 g.skill ds heat-sink package ? ? 2-11 asus v-series P5G43 ddr2 800 qualifed vendors list size vendor part . no. cl chip . brand ss/ ds . chip . no. dimm . ?upport a * b* c * 1g kingston khx6400d2ll/1g n/a kingston ds heat-sink package ? ? 512mb kingston khx6400d2llk2/1gn n/a kingston ss heat-sink package ? ? ? 512mb kingston kvr800d2n5/512 n/a promos ss v59c1512804qcf25sy032406pecp a ? ? ? 1g(kit of 2) kingston khx6400d2k2/2g n/a kingston ds heat-sink package ? ? 512mb kingston kvr800d2n6/512 n/a elpida ss e5108ajbg-8e-e ? ? ? 1g kingston kvr800d2n6/1g n/a elpida ds e5108ajbg-8e-e ? ? 2g kingston kvr800d2n5/2g n/a elpida ds e1 108acbg-8e-e ? ? 2g kingston khx6400d2/2g n/a kingston ds heat-sink package ? ? 4g kingston kvr800d2n6/4g n/a elpida ds e2108abse-8g-e ? ? 512mb samsung m378t6553gzs-cf7 6 samsung ss k4t51083qg-hcf7 ? ? ? 1g samsung m378t2863qzs-cf7 6 samsung ss k4t1g084qq-hcf7 ? ? ? 1g samsung m378t2953gz3-cf7 6 samsung ds k4t51083qg-hcf7 ? ? 2g samsung m37875663qz3-cf7 6 samsung ds k4t1g084qq-hcf7 ? ? 4g samsung m378t5263az3-cf7 n/a samsung ds k4t2g084qa-hcf7 ? ? 512mb qimonda hys64t64000eu-2.5-b2 6 qimonda ss hyb18t512800b2f25fss28380 ? ? ? 1g qimonda hys64t128020eu-2.5-b2 6 qimonda ds hyb18t512800b2f25fss28380 ? ? 1g corsair xms2-6400 4 corsair ds heat-sink package ? ? 1g corsair xms2-6400 5 corsair ds heat-sink package ? ? 2g(kit of 2) corsair cm2x2048-6400c5dhx 5 corsair ds heat-sink package ? ? 2g(kit of 2) corsair cm2x2048-6400c5 5 corsair ds heat-sink package ? ? 512mb hy hymp564u64cp8-s5 ab 5 hynix ss hy5ps12821cfp-s5 ? ? ? 1g hy hymp512u64cp8-s5 ab 5 hynix ds hy5ps12821cfps5 ? ? 512mb kingmax kldc28f-a8ki5 n/a kingmax ss kka8ff1xf-jfs-25a ? ? ? 1g kingmax kldd48f-a8k15 n/a kingmax ds kka8ffixf-hfs-25a ? ? 2g g.skill f2-6400cl5d-4gbpq 5 g.skill ds heat-sink package ? ? 2g g.skill f2-6400cl4d-4gbpk 4 g.skill ds heat-sink package ? ? 512mb(kit of 2) g.skill f2-6400cl5d-1gbnq 5-5- 5-15 g.skill ss heat-sink package ? ? ? 1g ocz ocz2rpr8002gk 4 ocz ds heat-sink package ? ? 1g ocz ocz2g800r22gk 5 ocz ds heat-sink package ? ? 1g ocz ocz2p800r22gk 4 ocz ds heat-sink package ? ? 1g ocz ocz2vu8004gk 6 ocz ds heat-sink package ? ? 2g ocz ocz2p8004gk 5 ocz ds heat-sink package ? ? 1g elixir m2y1g64tu8hb0b-25c 5 elixir ds n2tu51280be-25c802006z1dv ? ? (continued on the next page) 2-12 chapter 2: basic installation size v endor part . no. cl chip . brand ss/ ds . chip . no. dimm . ?upport a* b * c * 512mb apacer 78.91g91.9k5 5 apacer ss am4b5708jqjs8e0751c ? ? ? 1g apacer 78.01ga0.9k5 5 apacer ss am4b5808cqjs8e0749d ? ? ? 2g apacer 78.a1ga0.9k4 5 apacer ds am4b5808cqjs8e0740e ? ? 2g apacer 78.a1ga0.9k4 5 apacer ds am4b5808cqjs8e0747d ? ? 1g ada t a ad2800e001gu 444-12 n/a ss heat-sink package ? ? ? 1g t ranscend ts128mlq64v8j 5 mircon ds 7hd22d9gmh ? ? 512mb t ranscend ts64mlq64v8j512mb 5 micron ss 7hd22 d9gmh ? ? ? 1g t ranscend ts128mlq64v8j 5 t ranscend ds tq123pjf8f0801 ? ? 512mb ada t a m2oad6g3h3160q1e58 n/a ada t a ss ad29608a8a-25eg80812 ? ? ? 512mb vda t a m2gvd6g3h3160q1e52 n/a vda t a ss vd29608a8a-25eg20813 ? ? ? 1g ada t a m2oad6g314170q1e58 n/a ada t a ds ad29608a8a-25eg80810 ? ? 1g vda t a m2gvd6g314170q1e58 n/a vda t a ds vd29608a8a-25eg80813 ? ? 1g psc al7e8f73c-8e1 5 psc ss a3r1ge3cff734maa0e ? ? ? 2g psc al8e8f73c-8e1 5 psc ds a3r1ge3cff734maa0e ? ? 1g geil gb22gb6400c4dc 4 geil ds gl2l64m088ba30eb ? ? 1g geil gb24gb6400c4qc 4 geil ds gl2l64m088ba30eb ? ? 1g geil gb22gb6400c5dc 5 geil ds gl2l64m088ba30eb ? ? 1g geil gb24gb6400c5qc 5 geil ds gl2l64m088ba30eb ? ? 1g geil gx22gb6400dc 5 geil ds heat-sink package ? ? 1g geil ge22gb800c4dc 4 geil ds heat-sink package ? ? 1g geil ge24gb800c4qc 4 geil ds heat-sink package ? ? 1g geil gx22gb6400udc 4 geil ds heat-sink package ? ? 1g geil ge22gb800c5dc 5 geil ds heat-sink package ? ? 1g geil ge24gb800c5qc 5 geil ds heat-sink package ? ? 2g geil gb24gb6400c4dc 4 geil ds gl2l128m88ba25ab ? ? 2g geil gb24gb6400c5dc 5 geil ds gl2l128m88ba25ab ? ? 2g geil gb28gb6400c5qc 5 geil ds gl2l128m88ba25ab ? ? 2g geil gb28gb6400c4qc 4 geil ds gl2l128m88ba25ab ? ? 2g geil gx22gb6400lx 5 geil ds heat-sink package ? ? 2g geil gx24gb6400dc 5 geil ds heat-sink package ? ? 2g geil ge28gb800c5qc 5 geil ds heat-sink package ? ? 2g geil ge28gb800c4qc 4 geil ds heat-sink package ? ? 2g geil gx22gb6400cusc 4 geil ds heat-sink package ? ? 2g geil ge24gb800c4dc 4 geil ds heat-sink package ? ? 2g geil ge24gb800c5dc 5 geil ds heat-sink package ? ? 1g super t alent t800ub1gc4 4 super t alent ds heat-sink package ? ? 1g g.skill f2-6400cl5d-2gbnq 5 g.skill ds heat-sink package ? ? 1g g.skill f2-6400cl4d-2gbpk 4 g.skill ds heat-sink package ? ? 1g g.skill f2-6400cl4d-2gbhk 4 g.skill ds heat-sink package ? ? 2-13 asus v-series P5G43 ddr2-667mhz . capability size vendor part . no. cl chip . brand ss/ ds . chip . no. dimm . ?upport a* b* c* 512mb kingston kvr667d2n5/512 n/a hynix ss hy5ps12821efp-y5 ? ? ? 1g kingston kvr667d2n5/1g n/a hynix ds hy5ps12821efp-y5 ? ? 2g kingston kvr667d2n5/2g n/a micron ds 7re22 d9hnl ? ? 512mb qimonda hys64t64000eu-3s-b2 5 qimonda ss hyb18t512b00b2f3sfss28171 ? ? ? 1g qimonda hys64t128020eu-3s-b2 5 qimonda ds hyb18t512b00b2f3sfss28171 ? ? 1g corsair vs1gb667d2 n/a corsair ds mid095d62864m8cec ? ? 1g corsair xms2-5400 4 corsair ds heat-sink package ? ? 1g hy hymp512u64cp8-y5 ab 5 hynix ds hy5ps12521cfp-y5 ? ? 512mb kingmax klcc28f-a8kb5 n/a kingmax ss kkea88b4laug-29dx ? ? ? 1g kingmax klcd48f-a8kb5 n/a kingmax ds kkea88b4laug-29dx ? ? 512mb apacer au512e667c5kbgc 5 apacer ss am4b5708gqjs7e06332f ? ? ? 512mb apacer 78.91g92.9k5 5 apacer ss am4b5708jqjs7e0751c ? ? ? 1g apacer 78.01g9o.9k5 5 apacer ss am4b5808cqjs7e0751c ? ? ? 1g apacer au01ge667c5kbgc n/a apacer ds am4b5708gqjs7e0636b ? ? 1g apacer au01ge667c5kbgc 5 apacer ds am4b5708mijs7e0627b ? ? 2g apacer 78.a1g9o.9k4 5 apacer ds am4b5808cqjs7e0749b ? ? 1g t ranscend 506010-4894 5 elpida ds e5108ajbg-6e-e ? ? 512mb ada t a m2oad5g3h3160q1c52 n/a ada t a ss ad29608a8a-3eg20813 ? ? ? 1g ada t a m2oad5g314170q1c58 n/a ada t a ds ad29608a8a-3eg80814 ? ? 2g ada t a m2oad5h3j4170i1c53 n/a ada t a ds ad20908a8a-3eg 30724 ? ? 512mb psc al6e8e63j-6e1 5 psc ss a3r12e3jff717b9a00 ? ? ? 1g psc al7e8e63j-6e1 5 psc ds a3r12e3jff717b9a01 ? ? 1g psc al7e8f73c-6e1 5 psc ss a3r1ge3cff734maa0j ? ? ? 512mb nanya nt512t64u88a1by -3c n/a nanya ss nt5tu64m8ae-3c ? ? ? 1g nanya nt1gt64u8hb0by -3c 5 nanya ds nt5tu64m8be-3c72155700cp ? ? 1g geil gx21gb5300sx 3 geil ds heat-sink package ? ? 2g geil gx22gb5300lx 5 geil ds heat-sink package ? ? 2g geil gx24gb5300ldc 5 geil ds heat-sink package ? ? 1g(kit of 2) g.skill f2-5400phu2-2gbnt 5 - 5 - 5 - 1 5 g.skill ds d2 64m8ccf 0815 c7173s ? ? 2g(kit of 2) g.skill f2-5300cl5d-4gbmq 5 - 5 - 5 - 1 5 g.skill ds heat-sink package ? ? 667 1g super t alent t667ub1gv 5 super t alent ds pg 64m8-800 0750 ? ? 512mb t winmos 8d-a3jk5mpetp 5 psc ss a3r12e3gef633acaoy ? ? ? 4g samsung m378t5263az3-ce6 n/a samsung ds k4t2g084qa-hce6 ? ? 1g kingtiger e0736001024667 n/a kingtiger ds ktg667ps6408nst -c6 gdbtx ? ? 1g elixir m2y1g64tu8ha2b-3c 5 elixir ds m2tu51280ae-3c717095r28f ? ? 1g elixir m2y1g64tu8hbob-3c 5 elixir ds n2tu51280be-3c639009w1cf ? ? 1g leadmax lrmp512u64a8-y5 n/a hynix ds hy5ps12821cfp-y5 c 702aa ? ? 2-14 chapter 2: basic installation visit the asus website for the latest ddr2-1066/800/667mhz qvl. ss . - . single-sided . / . ds . - . double . - . sided . dimm . support: ? . a*: supports one module inserted into any slot as single-channel memory confguration. ? . b*: supports one pair of modules inserted into either the yellow slots or the black slots as one pair of dual-channel memory confguration. ? . c*: supports 4 modules inserted into both the yellow and black slots as two pairs of dual-channel memory confguration. 2-15 asus v-series P5G43 2.5.3 . removing . a . ddr2 . dimm follow these steps to remove a dimm. 1. simultaneously press the retaining clips outward to unlock the dimm. 2. remove the dimm from the socket. support the dimm lightly with your fngers when pressing the retaining clips. the dimm might get damaged when it fips out with extra force. 2.5.2 . installing . a . ddr2 . dimm 3. firmly insert the dimm into the socket until the retaining clips snap back in place and the dimm is properly seated. 1. unlock a ddr2 dimm socket by pressing the retaining clips outward. 2. align a dimm on the socket such that the notch on the dimm matches the break on the socket. locked . retaining . clip make sure to unplug the power supply before adding or removing dimms or other system components. failure to do so may cause severe damage to both the motherboard and the components. a ddr2 dimm is keyed with a notch so that it fts in only one direction. do not force a dimm into a socket to avoid damaging the dimm. ddr2 . dimm . notch 1 2 1 3 unlocked . retaining . clip 1 1 ddr2 . dimm . notch 2 2-16 chapter 2: basic installation 2.6 expansion slots in the future, you may need to install expansion cards. the following sub - sections describe the slots and the expansion cards that they support. 2.6.1 . installing . an . expansion . card t o install an expansion card: 1. before installing the expansion card, read the documentation that ca me with it and make the necessary hardware settings for the card. 2. remove the system unit cover (if your motherboard is already insta lled in a chassis). 3. remove the bracket opposite the slot that you intend to use. keep th e screw for later use. 4. align the card connector with the slot and press frmly until the card is completely seated on the slot. 5. secure the card to the chassis with the screw you removed earlier . 6. replace the system cover. make sure to unplug the power cord before adding or removing expansion cards. failure to do so may cause you physical injury and damage motherboard components. 2.6.2 confguring an expansion . card after installing the expansion card, confgure it by adjusting the software s ettings. 1. t urn on the system and change the necessary bios settings, if any . see chapter 5 for information on bios setup. 2. assign an irq to the card. refer to the tables on the next page. 3. install the software drivers for the expansion card. when using pci cards on shared slots, ensure that the drivers support share irq or that the cards do not need irq assignments. otherwise, conficts will arise between the two pci groups, making the system unstable and the card inoperable. 2-17 asus v-series P5G43 interrupt . assignments * these irqs are usually available for pci devices. irq priority standard . function 0 1 system t imer 1 2 keyboard controller 2 - re-direct to irq#9 3 10 communications port (com1) 4 1 1 irq holder for pci steering* 5 12 standard floppy disk controller 6 13 printer port (lpt1) 7 3 system cmos/real t ime clock 8 4 irq holder for pci steering* 9 5 irq holder for pci steering* 10 6 irq holder for pci steering* 1 1 7 ps/2 compatible mouse port 12 8 numeric data processor 13 9 primary ide channel irq . assignments . for . this . motherboard a b c d e f g h . pci1 shared shared shared shared pciex1_1 shared shared shared shared pciex1_2 shared shared shared shared onboard usb controller 1 shared onboard usb controller 2 shared onboard usb controller 3 shared onboard usb controller 4 shared onboard usb 2.0 controlle shared onboard hd audio shared onboard lan used onboard 1394 controller used onboard marvell ide controller used 2-18 chapter 2: basic installation 2.6.3 . pci . slots the pci slots support cards such as a lan card, scsi card, usb card, and other cards that comply with pci specifcations. the fgure shows a lan card installed on a pci slot. 2.6.4 . pci . express . x1 . slot this motherboard supports pci express x1 network cards, scsi cards and other cards that comply with the pci express specifcations. the fgure shows a network card installed on the pci express x1 slot. 2.6.5 . pci . express . x16 . slot this motherboard supports pci express x16 graphic cards that comply with the pci express specifcations. the fgure shows a graphics card installed on the pci express x16 slot. 2-19 asus v-series P5G43 2.7 installing an optical drive refer to the instructions in this section if you wish to install a new optica l drive. follow these steps to install an optical drive: 1. place the chassis upright. 2. remove the drive slot metal plate cover . 3. insert the optical drive into the upper 5.25-inch drive bay and carefu lly push the optical drive into the bay until its screw holes align with the holes on th e bay as shown. 4. secure the optical drive with two screws on both sides of the bay . ide . ribbon . cable power . cable 5. connect a power cable from the power supply to the power connector at the back of the optical drive. 6. connect one end of the ide ribbon cable to the ide interface at the back of the optical drive, matching the red stripe on the cable with pin 1 on the ide interface. 3 4 4 2-20 chapter 2: basic installation 7. connect the other end of the ide ribbon cable to the secondary id e connector (labeled sec_ide) on the motherboard. see page 4-7 for the location of this connector . 8. remove the dummy drive slot cover from the front panel. 9. replace the front panel. 2.8 installing a hard disk drive t o install a serial a t a hard disk drive: 1. carefully place the hard disk into the the lowest 3.5-inch drive slot (without the metal plate cover). 2. fasten the screws to secure the hard disk to the drive slot. the lowest 3.5-inch drive slot without the metal plate cover 3. connect one end of the serial ata cable to the sata connector at the back of the drive, then connect the other end to a serial ata connector on the motherboard. see page 4-6 for the location of the serial ata connectors. if you do not need to install the optional card reader into your system, you can install the hdd in the one of the 3.5-inch external bay (with the metal plate cover). 2-21 asus v-series P5G43 4. connect a 15-pin serial a t a power plug from the power supply uni t to the 15-pin power connector at the back of the drive. - . or . - connect a 4-pin (female) power plug from the power supply unit to the 4-pin (male) power connector at the back of the drive. serial . ata . cable serial . ata . power . cable if your serial ata hdd has both 4-pin and 15-pin connectors at the back, use either the 15-pin sata power adapter plug or the legacy 4 - pin power connector. do . not use both to prevent damage to components and to keep the system from becoming unstable. t o install an ide hard disk drive: 1. follow steps 1-2 of the previous section. 2. connect the blue interface of the ide ribbon cable to the primary id e connector (blue connector labeled pri_ide) on the motherboard. see p age 4-7 for the location of the connector. ide . ribbon . cable power . cable 2-22 chapter 2: basic installation 3. connect the gray interface of the ide ribbon cable to the ide conne ctor on the drive. 4. if you install two ide hard disk drives, connect the black interface of th e ide ribbon cable to the ide connector on the second (slave) ide hard disk d rive. 5. connect a 4-pin power plug from the power supply unit to the power connector at the back of the drive(s). ? if you will install only one hard disk drive, make sure to confgure your hard disk drive as master device before connecting the ide cable and power plug. refer to the hdd documentation on how to set the drive as a master device. ? if you will install two ide hard disk drives, confgure the other device as slave. 2.9 installing the card reader an optional card reader module (see the fgure below) is available with t he system. if you want to install the card reader into your system, follow the steps o n the next page. note: the card reader is optional and users need to purchase separately. 2-23 asus v-series P5G43 t o install the card reader module: 1. remove the drive slot metal plate cover . 2. carefully insert the card reader module into the 3.5-inch bay until th e screw holes align with the holes on the bay . 3. secure the card reader module with two screws on both sides. 4. connect the usb cable of the card reader to the usb connector on the motherboard. remove the metal plate cover and install the card reader module here 2-24 chapter 2: basic installation 2.10 installing a foppy disk drive the system comes with one 3.25-inch drive bay for a foppy disk drive. t o install a foppy disk drive: 1. remove the drive slot metal plate cover . 2. carefully insert the foppy disk drive into the foppy drive bay until th e screw holes align with the holes on the bay . 3. secure the foppy disk drive with two screws on both sides. 4. connect the foppy disk drive signal cable to the signal connector at th e back of the drive. 5. connect the other end of the signal cable to the foppy disk drive co nnector on the motherboard. see page 4-6 for the location of the foppy disk drive connector . 6. connect a 4-pin power cable from the power supply unit to the power connector at the back of the foppy disk drive. floppy . ribbon . cable power . cable 2 3 3 3 remove the metal plate cover and install the card reader module here 3 2-25 asus v-series P5G43 2.11 re-connecting cables y ou may have disconnected some cables when you were installing com ponents. you must re-connect these cables before you replace the chassis cover. led . cables connect the reset button , power switch , power led , and hdd led cables to their respective leads in the system panel connector on the motherboard. hdd . led power . led power . switch reset . button i p5ql-em. system.panel.connector p5ql-em r * requires an a t x power supply ne l pled- pwr +5v speaker ground reset ground reset ground ground pwrs w pled+ ide_led- ide_led+ ide_le d pled speaker pa 2-26 chapter 2: basic installation 2.12 reinstalling the cover if you installed an optical and/or foppy disk drive, remove the bay cover (s) on the front panel assembly before reinstalling it to the chassis. t o do this: 1. locate the bay cover locks. 2. press the locks outward to release the bay cover . 3. push the bay cover inward, then set it aside. 4. follow the same instructions to remove the 3.5 drive bay cover. t o reinstall the front panel assembly and side cover: 1. insert the front panel assembly hinge-like tabs to the holes on the rig ht side of the chassis. 2. swing the front panel assembly to the left, then insert the hooks to the chassis until the front panel assembly fts in place. 3. insert the six side cover hooks into the chassis tab holes . 4. p u s h t h e s i d e c o v e r t o t h e d i r e c t i o n o f t h e f r o n t p a n e l u n t i l i t f t s i n p l a c e . 5. secure the cover with two screws you removed earlier. if the air duct interferes with the cpu fan, adjust the air duct accordingly. air . duct 2 1 3 2 5 5 1 1 2 2 4 chassis . tab . holes this chapter helps you power up the system and install drivers and utilities from the support dvd. chapter 3 starting up r r 3-2 chapter 3: starting up 3.1 installing an operating system the barebone system supports windows ? xp/v ista operating systems (os). always install the latest os version and corresponding updates so you c an maximize the features of your hardware. 3.3 support dvd information the support dvd that came with the system contains useful software and several utility drivers that enhance the system features. 3.2 powering up press the system power button ( ) to enter the os. because motherboard settings and hardware options vary, use the setup procedures presented in this chapter for general reference only. refer to your os documentation for more information. ? screen display and driver options may not be the same for dif ferent operating system versions. ? the contents of the support dvd are subject to change at any time without notice. visit the asus website for updates. ? windows xp os setup cannot recognize serial a t a hard drives without the necessary drivers. use the bundled foppy disk when installing windows xp os to a serial a t a hard drive. ? from the windows xp setup screen, press f6 when prompted then follow succeeding screen instructions to install the sata drivers. r press . to . turn . on . the . system 3-3 asus v-series P5G43 3.3.1 . running . the . support . dvd to begin using the support dvd, place the dvd in your optical drive. the dvd automatically displays the drivers menu if autorun is enabled in your computer. if autorun is not enabled in your computer, browse the contents of the support dvd to locate the fle assetup.exe from the bin folder. double-click the assetup.exe to run the dvd. click . an . item . to . install click . an . icon . to . display . support . dvd/motherboard . information asus . install-installation . wizard . for . anti-virus . and . drivers . utility launches the asus install driver installation wizard. norton . internet . security . 2008 installs the norton internet security 2008. realtek . audio . driver installs the realtek ? alc1200 audio driver and application. intel . chipset . inf . update . program installs the intel ? chipset inf update program. intel . graphics . accelerator . driver installs the intel ? graphics accerlerator driver. realtek . rtl8111b/c . 10/100/1000m . lan . driver installs the realtek ? rtl8111b/c 10/100/1000m lan driver. asus . epu-4 . engine installs the asus epu-4 engine. 3-4 chapter 3: starting up 3.3.2 . utilities . menu the utilities menu shows the applications and other software that the motherboard supports. asus . install-installation . wizard . for . utilities installs all of the utilities through the installation wizard. asus . update . allows you to download the latest version of the bios from the asus website. before using the asus update, make sure that you have an internet connection so you can connect to the asus website. asus . pc . probe . ii this smart utility monitors the fan speed, cpu temperature, and system v oltages, and alerts you of any detected problems. this utility helps you keep your c omputer in healthy operating condition. realtek . diagnostics . utility installs the realtek ? diagnostics utility adobe . acrobat . reader . 8 installs the adobe ? acrobat ? reader that allows you to open, view, and print documents in portable document format (pdf). 3-5 asus v-series P5G43 microsoft . directx . 9.0c installs the microsoft ? directx 9.0c driver . the microsoft directx ? 9.0c is a multimedia technology that enhances computer graphics and sound. dir ectx ? improves the multimedia features of you computer so you can enjoy wat ching tv and movies, capturing videos, or playing games in your computer . v isit the microsoft website (www .microsoft.com) for updates. corel . mediaone . starter installs the corel mediaone starter application to easily manage, edit sh are and protect your multimedia data. cyberlink . powerbackup installs cyberlink powerbackup to back up and restore your data easily. ulead . burn. . now installs the ulead burn. now application for audio dvd,cd and data disc creation. ulead . photolmpact . 12 . se installs the photolmpact image editing software. you can also install the following utilities from the asus superb software library dvd. asus . express . gate . installer installs the asus express gate installer. 3-6 chapter 3: starting up asus . ai . nap installs the asus ai nap. marvell . 61xx . sata . raid . controller . driver installs the marvell 61xx sata raid controller driver. farstone . utility installs the farstone utility. asus . screen . saver installs the asus screen saver . 3.3.3 . manual . menu the manual menu contains a list of supplementary user manuals. click an item to open the folder of the user manual. most user manual fles are in portable document format (pdf). install the adobe ? acrobat ? reader from the asus superb software library dvd before opening a user manual fle. asus . motherboard . installation . guide allows you to open the asus motherboard installation guide. nis . 2008 . subscription . renewal . guide allows you to open the nis 2008 subscription renewal guide. 3-7 asus v-series P5G43 3.3.4 . asus . contact . information click the contact tab to display the asus contact information. y ou can also fnd this information on the inside front cover of this user guide. realtek . hd . audio . users . manual allows you to open the realtek hd audio users manual. 3-8 chapter 3: starting up 3.3.5 . other . information the icons on the top right corner of the screen give additional informatio n on the motherboard and the contents of the support dvd. click an icon to displa y the specifed information. motherboard . info displays the general specifcations of the motherboard. browse . this . dvd displays the support dvd contents in graphical format. 3-9 asus v-series P5G43 technical . support . form displays the asus technical support request form that you have to fll out when requesting technical support. filelist displays the contents of the support dvd and a brief description of each in text format. 3-10 chapter 3: starting up 3.4 software information most of the applications in the support dvd have wizards that will conven iently guide you through the installation. v iew the online help or readme fle th at came with the software for more information. asus . pc . probe . ii pc probe ii is a utility that monitors the computers vital components an d alerts you of any problem with these components. pc probe ii senses fan rota tions, cpu temperature, and system voltages, among others. pc probe ii is softwa re-based, allowing you to start monitoring your computer the moment you turn it on. w ith this utility , you are assured that your computer is always at a healthy opera ting condition. installing . pc . probe . ii t o install pc probe ii on your computer: 1. place the support dvd to the optical drive. the drivers installation tab appears if your computer has an enabled autorun feature. click . to . close . the . preference . panel 2. click the utilities tab, then click asus . pc . probe . ii . 3. follow the screen instructions to complete installation. launching . pc . probe . ii y ou can launch the pc probe ii right after installation or anytime from the windows ? desktop. to launch the pc probe ii from the windows ? desktop, click start . > . all . programs . > . asus . > . pc . probe . i i . the pc probe ii main window appears. after launching the application, the pc probe ii icon appears in the windows ? taskbar . click this icon to close or restore the application. using . pc . probe . ii main window the pc probe ii main window allows you to view the current status of your system and change the utility confguration. by default, the main window displays the preference section. you can close or restore the preference section by clicking on the triangle on the main window right handle. if autorun is not enabled in your computer, browse the contents of the support cd to locate the setup.exe fle from the asus pc probe ii folder. double-click the setup.exe fle to start installation. 3-11 asus v-series P5G43 button function opens the confguration window opens the report window opens the desktop . management . interface window opens the peripheral . component . interconnect window opens the windows . management . instrumentation window opens the hard disk drive, memory, cpu usage window shows/hides the preference section minimizes the application closes the application sensor alert when a system sensor detects a problem, the main window right handle turns red, as the illustrations below show . when displayed, the monitor panel for that sensor also turns red. refer to the monitor . panels section for details. preferences you can customize the application using the preference section in the main window. click the box before each preference to activate or deactivate. 3-12 chapter 3: starting up hardware . monitor . panels the hardware monitor panels display the current value of a system senso r such as fan rotation, cpu temperature, and voltages. the hardware monitor panels come in two display modes: hexagonal (large) and rectangular (small). when you check the enable . monitoring . panel option from the preference section, the monitor panels appear on your computers desktop. changing the monitor panels position t o change the position of the monitor panels on the desktop, click the arrow down button of the scheme options, then select another position from the list box. click ok when fnished. moving the monitor panels all monitor panels move together using a magnetic ef fect. if you want to detach a monitor panel from the group, click the horseshoe magnet icon. y ou can now move or reposition the panel independently . adjusting the sensor threshold value y ou can adjust the sensor threshold value in the monitor panel by clicking the arrow buttons. y ou can also adjust the th reshold values using the confg window . you cannot adjust the sensor threshold values in a small monitoring panel. large . display small . display click . to . increase . value click . to . decrease . value 3-13 asus v-series P5G43 monitoring sensor alert the monitor panel turns red when a component value exceeds or is lower than the threshold value. refer to the illustrations below. large . display small . display wmi . browser click to display the wmi (windows management instrumentation) browser. this browser displays various windows ? management information. click an item from the left panel to display on the right panel. click the plus sign (+) before wmi . information to display the available information. y ou can enlarge or reduce the browser size by dragging the bottom right corner of the browser . dmi . browser click to display the dmi (desktop management interface) browser . this browser displays various desktop and system information. click the plus sign (+) before dmi . information to display the available information. 3-14 chapter 3: starting up pci . browser click to display the pci (peripheral component interconnect) browser. this browser provides information on the pci devices installed on your system. click the plus sign (+) before the pci . information item to display available information. usage the usage browser displays real-time information on the cpu, hard disk drive space, and memory usage. click to display the usage browser . cpu usage the cpu tab displays real-time cpu usage in line graph representation. if the cpu has an enabled hyper- threading, two separate line graphs display the operation of the two logical processors. hard disk drive space usage the . hard . disk tab displays the used and available hard disk drive space. the left panel of the tab lists all logical drives. click a hard disk drive to display the information on the right panel. the pie chart at the bottom of the window represents the used (blue) and the available hdd space. 3-15 asus v-series P5G43 memory usage the memory tab shows both used and available physical memory. the pie chart at the bottom of the window represents the used (blue) and the available physical memory. confguring pc probe ii click to view and adjust the sensor threshold values. the confg window has two tabs: sensor/threshold and preference . the sensor/threshold tab enables you to activate the sensors or to adjust the sensor threshold values. the preference tab allows you to customize sensor alerts, change temperature scale, or enable the q-fan feature. loads . the . default . threshold . values . for . each . sensor applies . your . changes cancels . or . ignores . your . changes loads . your . saved . confguration saves . your . confguration 3-16 chapter 3: starting up this chapter gives information about he motherboard that comes with the system. this chapter includes the motherboard layout, jumper settings, and connector locations. chapter 4 motherboard information r r 4-2 chapter 4: motherboard info 4.1 introduction the v intage v -series p5g33 barebone system comes with an asus motherboard. this chapter provides technical information about the motherboard for futu re upgrades or system reconfguration. 4.2 motherboard layout p5ql-em r 24.4cm(9.6in) pciex16 pciex1_2 pci1 pciex1_1 usb1 1 12 usb910 usbpw9-12 usbpw78 usb78 ps2_usbpw5-6 usbpw1-4 8mb bios super i/o cr2032 3v lithium cell cmos power 24.4cm(9.6in) ps/2kbms usb56 rtl 81111c lga775 pwr_f an cpu_ f an intel ich10 marvell 61 1 1b2 intel g43 f l o p p y c o m 1 s a t a 1 2 s a t a 3 4 s a t a 5 6 clr tc sb_pwr cd ddr2 dimm_a1 (64 bit,240-pin module) ddr2 dimm_a2 (64 bit,240-pin module) ddr2 dimm_b1 (64 bit,240-pin module) ddr2 dimm_b2 (64 bit,240-pin module) p a n e l jmb381 p r i _ e i d e r tm870t -954 alc1200 lpt aafp spdif_out chassis lan1_usb12 1394 esa t a usb34 audio hdmi vga_dvi cha_f an ea txpw r a t x 1 2 v 4-3 asus v-series P5G43 4.3 jumpers 1. . clear . rtc . ram . (clrtc) this jumper allows you to clear the real t ime clock (r tc) ram in cmos. y ou can clear the cmos memory of date, time, and system setup parameters by erasing the cmos r tc ram data. the onboard button cell battery powers the ram data in cmos, which include system setup information such as system passwords. t o erase the r tc ram: 1. t urn off the computer and unplug the power cord. 2. remove the onboard battery . 3. move the jumper cap from pins 1-2 (default) to pins 2-3. keep the cap on pins 2-3 for about 5~10 seconds, then move the cap back to pins 1-2. 4. re-install the battery . 5. plug the power cord and turn on the computer . 6. hold down the 4-4 chapter 4: motherboard info p5ql-em. usb.device.w ake.up p5ql-em r 3 2 2 1 usbpw1-4 +5v (default) +5vsb 3 2 2 1 ps2_usbpw5-6 +5v (default) +5vsb 3 2 2 1 usbpw9-12 +5v (default) +5vsb 3 2 2 1 usbpw78 +5v (default) +5vsb 2. . usb . device . wake-up . (3-pin . usbpw1-4, . usbpw5-8, . usbpw9-12) set these jumpers to +5v to wake up the computer from s1 sleep mode (cpu stopped, dram refreshed, system running in low power mode) usin g the connected usb devices. set to +5vsb to wake up from s3 and s4 sle ep modes. the usbpw1-4 jumpers are for the rear usb ports. the usbpw5-8 and usbpw910 jumpers are for the internal usb connectors that you can connect to additional usb ports. ? the usb device wake-up feature requires a power supply that can provide 500ma on the +5vsb lead for each usb port; otherwise, the system will not power up. ? the total current consumed must not exceed the power supply capability (+5vsb) whether under normal condition or in sleep mode. 4-5 asus v-series P5G43 4.3 connectors 1. . floppy . disk . drive . connector . (34-1 . pin . floppy) this connector is for the provided foppy disk drive (fdd) signal cable. in sert one end of the cable to this connector , then connect the other end to the signal connector at the back of the foppy disk drive. pin 5 on the connector is removed to prevent incorrect cable connection when using an fdd cable with a covered pin 5. p5ql-em. floppy.disk.drive.connector p5ql-em r note : orient the r e d m a r k i n g s o n the floppy ribbon cable to pin 1. pi n 1 floppy 4-6 chapter 4: motherboard info 2. . ide . connector . (40-1 . pin . pri_ide) the onboard ide connector is for ultra dma 133 / 100 / 66 / 33 signal cable. there are three connectors on each ultra dma 100/66/33 signal cable: blue, black, and gray. connect the blue connector to the motherboards ide connector, then select one of the following modes to confgure your device(s). ? pin 20 on the ide connector is removed to match the covered hole on the ultra dma cable connector . this prevents incorrect insertion when you connect the ide cable. ? use the 80-conductor ide cable for ultra dma 133 / 100 / 66 / 33 ide devices. if any device jumper is set as cable-select, ensure that all other device jumpers have the same setting. drive . jumper . setting mode . of . device(s) cable . connector single device cable-select or master - black t wo devices cable-select master black slave gray master master black or gray slave slave p5ql-em. ide.connector . p5ql-em r note: orient the red markings (usually zigzag) on the id ribbon cable to pin 1. pri_eide pin1 4-7 asus v-series P5G43 3. . ich9 . serial . ata . connectors . (7-pin . sata1 . [red], . sata2 . [black], . sata3 . [red], . sata4 . [black]) these connectors are for the serial ata signal cables for serial ata hard disk drives. connect the right-angle side of sata signal cable to sata device. or you may connect the right-angle side of sata cable to the onboard sata port to avoid mechanical confict with huge graphics cards. right angle side p5ql-em. s ata .connectors p5ql-em r gnd rs at a_txp1 rs at a_txn1 gnd rs at a_rxp1 rs at a_rxn1 gnd sa t a1 g n d r s a t a _ t x p 2 r s a t a _ t x n 2 g n d r s a t a _ r x p 2 r s a t a _ r x n 2 g n d sa t a2 g n d r s a t a _ t x p 3 r s a t a _ t x n 3 g n d r s a t a _ r x p 3 r s a t a _ r x n 3 g n d sa t a3 gnd r s a t a _ t x p 4 r s a t a _ t x n 4 g n d r s a t a _ r x p 4 r s a t a _ r x n 4 g n d sa t a 4 gn d r s a t a _ t x p 5 r s a t a _ t x n 5 g n d r s a t a _ r x p 5 r s a t a _ r x n 5 g n d sa t a5 g n d r s a t a _ t x p 6 r s a t a _ t x n 6 g n d r s a t a _ r x p 6 r s a t a _ r x n 6 g n d sa t a6 4-8 chapter 4: motherboard info 4. . digital . audio . connector . (4-1 . pin . spdif_out . for . asus . hdmi . vga . card) this connector is for an additional sony/philips digital interface (s/pdif) port(s). if you are using an asus hdmi-equipped graphics card, connect th e hdmi card to this connector with a s/pdif out cable. the asus hdmi-equipped graphics card and the s/pdif out cable are purchased separately. p5ql-em. digital. audio.connector p5ql-em r +5v spdifout gnd spdif_out 5. . usb . connectors . (10-1 . pin . usb78, . usb . 910, . usb1 1 12) these connectors are for usb 2.0 ports. connect the usb module cable to any of these connectors, then install the module to a slot opening at the back of the system chassis. these usb connectors comply with usb 2. 0 specifcation that supports up to 480 mbps connection speed. never connect a 1394 cable to the usb connectors. doing so will damage the motherboard! p5ql-em r p5ql-em. usb.2.0.connectors usb78 usb+5v usb_p8- usb_p8+ gnd nc usb+5v usb_p7- usb_p7+ gnd 1 usb910 usb+5v usb_p10- usb_p10+ gnd nc usb+5v usb_p9- usb_p9+ gnd 1 usb 1 1 1 2 usb+5v usb_p12- usb_p12+ gnd nc usb+5v usb_p1 1 - usb_p1 1 + gnd 1 you can connect the front panel usb cable to the asus q-connector (usb, blue) frst, and then install the q-connector (usb) to the usb connector onboard if your chassis supports front panel usb ports. the usb module cable is purchased separately. 4-9 asus v-series P5G43 6. . optical . drive . audio . connector . (4-pin . cd) these connectors allow you to receive stereo audio input from sound sources such as a cd-rom, tv tuner, or mpeg card. p5ql-em internal audio connector p5ql-em r cd (black) right a udio channel left a udio channel ground ground 7. . digital . audio . connector . (4-1 . pin . spdif_out) this connector is for the s/pdif audio module to allow digital sound output. connect one end of the s/pdif audio cable to this connector and the other end to the s/pdif module. p5ql-em. digital. audio.connector p5ql-em r +5v spdifout gnd spdif_out the s/pdif out module is purchased separately. 4-10 chapter 4: motherboard info 8. . cpu, . chassis, . and . power . fan . connectors . (4-pin . cpu_fan, . 3-pin . cha_fan1, . 3-pin . pwr_f an) the fan connectors support cooling fans of 350 ma~2000 ma (24 w max.) or a total of 1 a~7 a (84 w max.) at +12v. connect the fan cables to the fan connectors on the motherboard, making sure that the black wire of each cable matches the ground pin of the connector. do not forget to connect the fan cables to the fan connectors. insuffcient air fow inside the system may damage the motherboard components. these are not jumpers! do not place jumper caps on the fan connectors! only the cpu-fan connectors support the asus q-fan feature. p5ql-em. fan.connector s p5ql-em r cpu_ f a n gnd cpu fa n pw r cpu fa n in cpu fa n pw m pwr_f an gnd rotation +12v cha_f an gnd rotation +12v 9. . serial . port . connector . (10-1 . pin . com1) this connector is for a serial (com) port. connect the serial port module cable to this connector , then install the module to a slot opening at the ba ck of the system chassis. p5ql-em. com.port.connector p5ql-em r pi n 1 com1 the serial port module is purchased separately. 4-11 asus v-series P5G43 10. . chassis . intrusion . connector . (4-1 . pin . chassis) this connector is for a chassis-mounted intrusion detection sensor or switc h. connect one end of the chassis intrusion sensor or switch cable to this connector . the chassis intrusion sensor or switch sends a high-level sign al to this connector when a chassis component is removed or replaced. the signal is then generated as a chassis intrusion event. by default, the pin labeled chassis signal and ground are shorted with a jumper cap. remove the jumper caps only when you intend to use the chassis intrusion detection feature. p5ql-em. intrusion.connector p5ql-em r chassis +5vsb_mb chassis signal gnd (default) 1 1. . front . panel . audio . c o n n e c t o r . (10-1 . pin . aafp) this connector is for a chassis-mounted front panel audio i/o module tha t supports either hd audio or legacy ac`97 audio standard. connect one e nd of the front panel audio i/o module cable to this connector . ? we recommend that you connect a high-defnition front panel audio module to this connector to avail of the motherboards high-defnition audio capability. ? if you want to connect a high-defnition front panel audio module to this connector , set the front . panel . t ype item in the bios setup to [hd . audio]; . if you want to connect an ac'97 front panel audio module to this connector , set the item to [ac'97] . by default, this connector is set to [hd . audio] . . see section 5.4.5 onboard devices confguration for details. p5ql-em. front.panel. audio.connector p5ql-em r sense2_retur po rt 1l po rt 1r po rt 2r sebse_send po rt 2l sense1_retur presense# gnd aaf p legac y a c97 compliant definitio n nc mic2 line out_r line out_l nc nc micpwr nc agnd hd-audio-compliant pin definitio n 4-12 chapter 4: motherboard info ? for a fully confgured system, we recommend that you use a power supply unit (psu) that complies with a tx 12 v specifcation 2.0 (or later version) and provides a minimum power of 400 w . ? do not forget to connect the 4-pin ea tx12v power plug; otherwise, the system will not boot. ? use of a psu with a higher power output is recommended when confguring a system with more power-consuming devices. the system may become unstable or may not boot up if the power is inadequate. ? the a tx 12 v specifcation 2.0-compliant (400w) psu has been tested to support the motherboard power requirements with the following confguration: cpu: intel ? pentium ? extreme 3.73ghz memory: 512 mb ddr2 (x4) graphics card: asus eax1900xt parallel a t a device: ide hard disk drive serial a t a device: sa t a hard disk drive (x2) optical drive: dvd-r w ? if you want to use two high-end pci express x16 cards, use a psu with 500w to 600w power or above to ensure the system stability. 12. . atx . power . connectors . (24-pin . eatxpwr, . 4-pin . a tx12v) these connectors are for a tx power supply plugs. the power supply plu gs are designed to ft these connectors in only one orientation. find the pro per orientation and push down frmly until the connectors completely ft. p5ql-em. a tx.power.connector p5ql-em r ea txpw r +3 v olts +3 v olts ground +5 v olts +5 v olts ground ground power ok +5v standby +12 v olts -5 v olts +5 v olts +3 v olts -12 v olts ground ground ground pson# ground +5 v olts +12 v olts +3 v olts +5 v olts ground a t x12v gnd +12v dc gnd +12v dc 4-13 asus v-series P5G43 13. . system . panel . connector . (20-8 . pin . f_panel) this connector supports several chassis-mounted functions. ? . system . power . led . (2-pin . pled) this 2-pin connector is for the system power led. connect the chassis power led cable to this connector . the system power led lights up whe n you turn on the system power , and blinks when the system is in sleep mo de. ? . hard . disk . drive . activity . led . (2-pin . ide_led) this 2-pin connector is for the hdd activity led. connect the hdd activity led cable to this connector . the ide led lights up or fashes when data is read from or written to the hdd. ? . system . warning . speaker . (4-pin . speaker) this 4-pin connector is for the chassis-mounted system warning speake r . the speaker allows you to hear system beeps and warnings. ? . atx . power . button/soft-off . button . (2-pin . pwrsw) this connector is for the system power button. pressing the power button turns the system on or puts the system in sleep or soft-of f mode dependin g on the bios settings. pressing the power switch for more than four seco nds while the system is on turns the system off . ? . reset . button . (2-pin . reset) this 2-pin connector is for the chassis-mounted reset button for system reboot without turning off the system power. p5ql-em. system.panel.connector p5ql-em r * requires an at x power supply ne l pled- pwr +5v speake r ground reset ground reset ground ground pwrs w pled+ ide_led- ide_led+ ide_le d pled speaker p a 4-14 chapter 4: motherboard info bios setup this chapter tells how to change system settings through the bios setup menus and describes the bios parameters. chapter 5 r r 5-2 chapter 5: bios setup 5.1 managing and updating your bios the following utilities allow you to manage and update the motherboard b asic input/output system (bios) setup. 1. asus . update (updates the bios in windows ? environment.) 2. asus . ez . flash . 2 (updates the bios using a foppy disk or usb fash disk.) 3. asus . afudos (updates the bios using a bootable foppy disk.) 4. asus . crashfree . bios . 3 (updates the bios using a bootable foppy disk, usb fash disk or the motherboard support dvd when the bios fle fails o r gets corrupted.) refer to the corresponding sections for details on these utilities. save a copy of the original motherboard bios fle to a bootable foppy disk or usb fash disk in case you need to restore the bios in the future. copy the original motherboard bios using the asus update or afudos utilities. installing . asus . update t o install asus update: 1. place the support dvd in the optical drive. the drivers menu appe ars. 2. click the utilities tab, then click install . asus . update . 3. the asus update utility is copied to your system. 5.1.1 . asus . update . utility the asus update is a utility that allows you to manage, save, and update the motherboard bios in windows ? environment. the asus update utility allows you to: ? save the current bios fle ? download the latest bios fle from the internet ? update the bios from an updated bios fle ? update the bios directly from the internet, and ? v iew the bios version information. this utility is available in the support dvd that comes with the motherboard package. asus update requires an internet connection either through a network or an internet service provider (isp). quit all windows ? applications before you update the bios using this utility. asus v-series P5G43 5-3 3. select the asus ftp site nearest you to avoid network traffc, or click auto . select . click next . updating . the . bios . through . the . internet t o update the bios through the internet: 1. launch the asus update utility from the windows ? desktop by clicking start . > . programs . > . asus . > . asusupdate . > . asusupdate . the asus update main window appears. 2. select update . bios from the internet option from the drop - down menu, then click next . 5-4 chapter 5: bios setup updating the bios through a bios fle t o update the bios through a bios fle: 1. launch the asus update utility from the windows ? desktop by clicking start . > . programs . > . asus . > . asusupdate . > . asusupdate . the asus update main window appears. 2. select update bios from a fle option from the drop - down menu, then click next . 4. from the ftp site, select the bios version that you wish to download. click next . 5. follow the screen instructions to complete the update process. the asus update utility is capable of updating itself through the internet. always update the utility to avail all its features. 3. locate the bios fle from the open window , then click open . 4. follow the screen instructions to complete the update process. p5ql-em p5ql-em.rom asus v-series P5G43 5-5 5.1.2 creating a bootable foppy disk 1. do either one of the following to create a bootable foppy disk. dos environment a. insert a 1.44mb foppy disk into the drive. b. at the dos prompt, type format a: / s then press 5-6 chapter 5: bios setup t o update the bios using ez flash 2: 1. v isit the asus website (www .asus.com) to download the latest bios fle for the motherboard. 2. save the bios fle to a foppy disk or a usb fash disk, then restart the system. 5.1.3 . asus . ez . flash . 2 . utility the asus ez flash 2 feature allows you to update the bios without having to go through the long process of booting from a foppy disk and using a dos - b ased utility . the ez flash 2 utility is built-in the bios chip so it is accessible by pressing asus v-series P5G43 5-7 5.1.4 . afudos . utility the afudos utility allows you to update the bios fle in dos environme nt using a bootable foppy disk with the updated bios fle. this utility also allows y ou to copy the current bios fle that you can use as backup when the bios fails or gets corrupted during the updating process. copying . the . current . bios t o copy the current bios fle using the afudos utility: main flename extension . name 1. copy the afudos utility (afudos.exe) from the motherboard support dvd to the bootable foppy disk you created earlier. 2. boot the system in dos mode, then at the prompt type: afudos /o[flename] where the [flename] is any user-assigned flename not more than eight alphanumeric characters for the main flename and three alphanumeric characters for the extension name. a:>afudos /ooldbios1.rom ? make sure that the foppy disk is not write-protected and has at least 1024kb free space to save the fle. ? the succeeding bios screens are for reference only. the actual bios screen displays may not be same as shown. the utility returns to the dos prompt after copying the current bios fle. 3. press 5-8 chapter 5: bios setup 2. copy the afudos utility (afudos.exe) from the motherboard support d vd to the bootable foppy disk you created earlier . 3. boot the system in dos mode, then at the prompt type: afudos /i[flename] where [flename] is the latest or the original bios fle on the bootable fop py disk. a:\>afudos /ip5qlem.rom write the bios flename on a piece of paper. you need to type the exact bios flename at the dos prompt. 5. the utility returns to the dos prompt after the bios update process is completed. reboot the system from the hard disk drive. a:\>afudos /ip5qlem.rom a m i f i r m w a r e u p d a t e u t i l i t y - v e r s i o n 1 . 1 9 ( a s u s v 2 . 0 7 ( 0 3 . 1 1 . 2 4 b b ) ) copyright (c) 2002 american megatrends, inc. all rights reserved. warning!! do not turn off power during fash bios reading fle ....... done reading fash ...... done advance check ...... erasing fash ...... done writing fash ...... done verifying fash .... done please restart your computer a:\> a:\>afudos /ip5qlem.rom a m i f i r m w a r e u p d a t e u t i l i t y - v e r s i o n 1 . 1 9 ( a s u s v 2 . 0 7 ( 0 3 . 1 1 . 2 4 b b ) ) copyright (c) 2002 american megatrends, inc. all rights reserved. warning!! do not turn off power during fash bios reading fle ....... done reading fash ...... done advance check ...... erasing fash ...... done writing fash ...... 0x0008cc00 (9%) 4. the utility verifes the fle and starts updating the bios. do not shut down or reset the system while updating the bios to prevent system boot failure! asus v-series P5G43 5-9 5.1.5 . asus . crashfree . bios . 3 . utility the asus crashfree bios 3 is an auto recovery tool that allows you to restore the bios fle when it fails or gets corrupted during the updating process. y ou can update a corrupted bios fle using the motherboard support dvd, the fo ppy disk, or the usb fash disk that contains the updated bios fle. ? prepare the motherboard support dvd, the foppy disk or the usb fash disk containing the updated motherboard bios before using this utility . ? if you use a sata optical drive, always connect the sata cable to the sata1/sata2 connector; otherwise, the utility will not function. recovering . the . bios . from . the . support . dvd t o recover the bios from the support dvd: 1. t urn on the system. 2. insert the motherboard support dvd to the optical drive. 3. the utility displays the following message and automatically check s the dvd for the bios fle. 4. restart the system after the utility completes the updating process. ? only the usb fash disk with f a t 32/16 format and single partition can support asus crashfree bios 3. the device size should be smaller than 8gb. ? do not shut down or reset the system while updating the bios! doing so can cause system boot failure! when found, the utility reads the bios fle and starts fashing the co rrupted bios fle. recovering the bios from the usb fash disk t o recover the bios from the usb fash disk: 1. insert the usb fash disk that contains bios fle to the usb port. 2. t urn on the system. 3. the utility will automatically checks the devices for the bios fle when found, the utility reads the bios fle and starts fashing the corrupted bios fle. 4. restart the system after the utility completes the updating process. bad bios checksum. starting bios recovery... &khfnlqirurss\ bad bios checksum. starting bios recovery... &khfnlqirurss\ floppy found! 5hdglqoh34/(0520&rpsohwhg 6wduwdvklq 5-10 chapter 5: bios setup 5.2 bios setup program this motherboard supports a programmable serial peripheral interface (spi) chip that you can update using the provided utility described in section 5.1 m anaging and updating your bios. use the bios setup program when you are installing a motherboard, re confguring your system, or prompted to run setup. this section explains how to co nfgure your system using this utility . even if you are not prompted to use the setup program, you can change th e confguration of your computer in the future. for example, you can enab le the security password feature or change the power management settings. this requires you to reconfgure your system using the bios setup program so that the computer can recognize these changes and record them in the cmos r am of the spi chip. the spi chip on the motherboard stores the setup utility . when you start up the computer , the system provides you with the opportunity to run this progra m. press asus v-series P5G43 5-11 5.2.2 . menu . bar the menu bar on top of the screen has the following main items: main for changing the basic system confguration advanced for changing the advanced system settings power for changing the advanced power management (apm) confguration boot for changing the system boot confguration tools for confguring options for special functions exit for selecting the exit options and loading default setting s. t o select an item on the menu bar , press the right or left arrow key on the keyboard until the desired item is highlighted. 5.2.3 . navigation . keys at the bottom right corner of a menu screen are the navigation keys for that particular menu. use the navigation keys to select items in the menu and change the settings. 5.2.1 . bios . menu . screen some of the navigation keys differ from one screen to another. select screen select item +- change field tab select field f1 general help f10 save and exit esc exit v02.58 (c)copyright 1985-2008, american megatrends, inc. bios setup utility main advanced power boot tools exit use [enter], [tab] or [shift-tab] to select a feld. use [+] or [-] to confgure system time. system time [ 19 :34:30] system date [mon 05/12/2008] legacy diskette a [1.44m, 3.5 in.] sata 1 :[not detected] sata 2 :[not detected] sata 3 :[not detected] sata 4 :[not detected] sata 5 :[not detected] sata 6 :[not detected] storage confguration system information menu . items menu . bar &rqjxudwlrq hogv general . help sub-menu . items navigation . keys 5-12 chapter 5: bios setup 5.2.4 . menu . items the highlighted item on the menu bar displays the specifc items for that menu. for example, selecting main shows the main menu items. the other items (advanced, power , boot, and exit) on the menu bar have their respective menu items. 5.2.5 . sub-menu . items a solid triangle before each item on any menu screen means that the ite am has a sub-menu. t o display the sub-menu, select the item and press asus v-series P5G43 5-13 5.3 main menu when you enter the bios setup program, the main menu screen appea rs, giving you an overview of the basic system information. 5.3.1 . system . time . [xx:xx:xx] allows you to set the system time. 5.3.2 . system . date . [day . xx/xx/xxxx] allows you to set the system date. 5.3.3 . legacy . diskette . a . [1.44m, . 3.5 . in.] sets the type of foppy drive installed. confguration options: [disabled] [720k, 3.5 in.] [1.44m, 3.5 in.] refer to section 5.2.1 .. bios . menu . screen for information on the menu screen items and how to navigate through them. select screen select item +- change field tab select field f1 general help f10 save and exit esc exit v02.58 (c)copyright 1985-2008, american megatrends, inc. bios setup utility main advanced power boot tools exit use [enter], [tab] or [shift-tab] to vhohfwdhog use [+] or [-] to frqxuhv\vwhp time. system time [ 19 :34:30] system date [mon 05/12/2008] legacy diskette a [1.44m, 3.5 in.] sata 1 :[not detected] sata 2 :[not detected] sata 3 :[not detected] sata 4 :[not detected] sata 5 :[not detected] sata :[not detected] 6wrudh&rqxudwlrq system information 5-14 chapter 5: bios setup 5.3.4 . sata . 1~6 while entering setup, the bios automatically detects the presence of ide devices. there is a separate sub-menu for each ide device. select a device item then press asus v-series P5G43 5-15 pio . mode . [auto] selects the pio mode. confguration options: [auto] [0] [1] [2] [3] [4] dma . mode . [auto] selects the dma mode. confguration options: [auto] smart . monitoring . [auto] sets the smart monitoring, analysis, and reporting t echnology . confguration options: [auto] [disabled] [enabled] 32bit . data . transfer . [enabled] enables or disables 32-bit data transfer . confguration options: [disabled] [enabled] sa t a confguration [enhanced] confguration options: [disabled] [compatible] [enhanced] confgure sata as [ide] sets the confguration for the serial a t a connectors supported by the sou thbridge chip. the ahci allows the onboard storage driver to enable advanced serial a t a features that increases storage performance on random workloads by allo wing the drive to internally optimize the order of commands. if you want to use the serial a t a hard disk drives as parallel a t a physical storage devices, keep the defaul setting [ide]. if you want the serial ata hard disk drives to use the advanced host controller interface (ahci), set this item to [ahci]. 5.3.5 storage confguration the items in this menu allow you to set or change the confgurations for th e sata devices installed in the system. select an item then press 5-16 chapter 5: bios setup 5.3.6 . system . information this menu gives you an overview of the general system specifcations. the bios automatically detects the items in this menu. ami . bios displays the auto-detected bios information. processor displays the auto-detected cpu specifcation. system . memory displays the auto-detected system memory. hard . disk . write . protect . [disabled] . disables or enables device write protection. this will be ef fective only if device is accessed throuh bios. confuration option: [disabled] [enabled] sata . detect . time . out . (sec) . [35] selects the time out value for detecting a t a/a t api devices. confguration options: [0] [5] [10] [15] [20] [25] [30] [35] amibios version : 0302 build date : 08/01/08 processor type : intel(r) core(tm)2 cpu 6300 @ 1.86ghz speed : 1866mhz count : 2 system memory installed size: 512mb usable size: 478mb asus v-series P5G43 5-17 5.4 advanced menu the advanced menu items allow you to change the settings for the cpu and other system devices. take caution when changing the settings of the advanced menu items. incorrect feld values can cause the system to malfunction. 5.4.1 jumperfree confguration v02.58 (c)copyright 1985-2008, american megatrends, inc. bios setup utility main advanced power boot tools exit -xpshu)uhh&rqxudwlrq &38&rqxudwlrq chipset 2qerdug'hylfhv&rqxudwlrq 86&rqxudwlrq pcipnp select screen select item +- change field tab select field f1 general help f10 save and exit esc exit adjust system frequency/voltage. &rqxuh6\vwhp)uhtxhqf\9rowdh ai overclocking [auto] dram frequency [auto] memory over voltage [auto] nb voltage [auto] cpu voltage [auto] select the target cpu frequency, and the relevant parameters will be auto- adjusted. frequencies higher than cpu manufacturer recommends are not guaranteed to be stable. if the system becomes unstable, return to the default. ai overclocking [auto] allows selection of cpu overclocking options to achieve desired cpu inte rnal frequency . select either one of the preset overclocking confguration optio ns: - allows you to individually set overclocking parameters. auto - loads the optimal settings for the system. overclock profle - loads overclocking profles with optimal parameters for stability when overclocking. 5-18 chapter 5: bios setup the following item appears only when you set the ai . overclocking item to [manual] . fsb / cpu external frequency synchronization cpu . frequency . [xxx] displays the frequency sent by the clock generator to the system bus an d pci bus. the value of this item is auto-detected by the bios. use the <+> and <-> keys to adjust the cpu frequency . y ou can also type the desired cpu frequency using the numeric keypad. the values range from 200 to 600. refer to the table be low for the correct front side bus and cpu external frequency settings. overclock . options . [overclock . 5%] allows you to select the overclock options. confguration options: [overclo ck 5%] [overclock 10%] [overclock 15%] [overclock 20%] [overclock 30%] the following item appears only when you set the ai overclocking item to [overclock profle] . front . side . bus cpu . external . frequency fsb 1333 333 mhz fsb 1066 266 mhz fsb 800 200 mhz selecting a very high dram frequency may cause the system to become unstable! if this happens, revert to the default setting. fsb dram . frequency auto 667mhz 800mhz 960mhz 1000mhz 1067mhz 1 100mhz 1200mhz 1333 v v v v v 1066 v v v v 800 v v v the following table shows the dram frequency options that appear when the fsb value is 1333, 1066, and 800. dram . frequency . [auto] allows you to set the ddr2 operating frequency. confguration options: [auto] [667 mhz] [800 mhz] [1067mhz] asus v-series P5G43 5-19 memory . over . voltage . [auto] allows you to adjust memory over voltage and each step is 6.25mv nb . voltage . [auto] allows you to set the nb voltage. confguration options: [auto] [1.1v] [1.1 98v] [1.3v] [1.388v] cpu . voltage . [auto] allows you to set the cpu vcore voltage. the values range from 0.8500v to 1.55v with a 0.00625v interval. confguration options: [auto] setting a very high voltage may damage the component permanently, and setting a very low voltage may cause the system to become unstable. setting a very high voltage may damage the component permanently, and setting a very low voltage may cause the system to become unstable. 5.4.2 cpu confguration the items in this menu show the cpu-related information that the bios automatically detects. confgure advanced cpu settings 5-20 chapter 5: bios setup cpu . ratio . setting . [auto] sets the ratio between cpu core clock and the fsb frequency. confguration options: [auto]. if an invalid ratio is set in cmos then actual and setpoint values my differ. key in ratio numbers directly. c1e . support . [enabled] allows you to enable or disable inter cpu enhanced halt (c1e) function, a cpu power-saving function in system halt state. when enabled, the cpu core frequency and voltage will be reduced during the system halt state to de crease power consumption. confguration options: [disabled] [enabled] max . cpuid . value . limit . [disabled] allows you to determine whether to limit cpuid maximum value. set this item to [disabled] for windows xp operating system; set this item to [enabled] for legacy operating system such as windows nt4.0. (default: disabled) confguration options: [disabled] [enabled] vanderpool . technology . [enabled] enables or disables intel ? v irtualization t echnology . v irtualization enhanced by intel ? v irtualization t echnology allows a platform to run multiple operating syste ms and applications in independent partitons. with virtualization, one compu ter system can function as multiple virtual systems. confguration options: [e nabled] [disabled] cpu . tm . function . [enabled] enables or disables intel ? cpu thermal monitor (tm) function, a cpu overheating protection function. when enabled, the cpu core frequency and voltage a re reduced when the cpu overheats. confguration options: [disabled] [ena bled] execute . disable . bit . [enabled] enables or disables intel ? execute disable bit function. this function enhance protection of your computer , reducing exposure to viruses and malicious buffer overfow attacks when working with its supporting software and system. confguration options: [disabled] [enabled] the following item appears only when you installed an intel ? pentium ? 4 or later cpu that supports the enhanced intel speedstep ? technology (eist). asus v-series P5G43 5-21 intel ? . speedstep? . technology . [enabled] allows you to use the enhanced intel ? speedstep ? t echnology . when set to [enabled] , you can adjust the system power settings in the operating system to use the eist feature. set this item to [disabled] if you do not want to use the eist . confguration options: [enabled] [disabled] 5.4.3 . chipset the chipset menu allows you to change the advanced chipset settings. select an item then press 5-22 chapter 5: bios setup initiate . graphic . adapter . [peg/pci] allows you to select the graphics controller as the primary boot device. confguration options: [igd] [pci/igd] [pci/peg] [peg/igd][peg/pci] igd . graphics . mode . select . [enabled, . 32mb] sets the igd graphics mode. confguration options: [disabled] [enabled, 32mb] [enabled, 64mb] [ena bled, 128mb] dvmt . mode . select . [dvmt . mode] allows you to select the graphics memory type. confguration options: [dvmt mode] dvmt memory [256mb] configuration options: [128mb] [256mb] [maximum dvmt] this option only appears when installing 1gb ddr2 dimms into the dimm sockets. protect . audio . video . path . mode . [lite] allows you to set p a vp mode. confguration options: [disabled] [lite] [paranoid] to use the high-bandwidth digital content protection (hdcp) function, set this option to either [lite] or [paranoid] . if you select paranoid mode, the system reserves 96mb for playing and storing the decrypted contents. the operation system and other programs cannot use this reserved memory, and vista aero (dwm) is disabled. feature pavp . lite pavp . paranoid compressed video buf fer is encrypted y es y es hw 128-bit aes decryption y es y es protected memory (96mb reserved during boot) no yes asus v-series P5G43 5-23 south bridge confguration audio . controller . [enabled] allows you to set the audio controller . confguration options: [enabled] [d isabled] front panel support t ype [hd audio] allows you to select the front panel support type. if high defnition audio front panel used, please set hd audio mode. confguration options: [ac 97] [hd audio] spdif_out mode setting [spdif output] allows you to select spdif_out mode setting. confguration options: [h dmi output] [spdif output] options 6rxwkulgh&klsvhw&rqxudwlrq audio controller [enabled] front panel type [hd audio ] spdif_out mode setting [spdif output] 5.4.4 onboard devices confguration onboard device conguration onboard lan [enabled] lan option rom [disabled] marvell ide controller [enabled] 1394 controller [enabled] serial port1 address [3f8/irq4] parallel port address [378] parallel port mode [ecp] ecp mode dma channel [dma3] parallel port irq [irq7] onboard pciex gbe lan_ enable/disable 5-24 chapter 5: bios setup onboard . lan . [enabled] allows you to enable or disable the onboard lan controller. confguration options: [enabled] [disabled] lan option rom [disabled] allows you to enable or disable the lan option rom in the onboard lan controller . this item appears only when the onboard lan item is set to enabled. confguration options: [disabled] [enabled] marvell . ide . controller . [enabled] allows you to enable or disable marvell ide controller . confguration options: [enabled] [disabled] 1394 . controller . [enabled] allows you to enable or disable 1394 controller. confguration options: [enabled] [disabled] serial . port1 . address . [3f8/irq4] allows you to select the serial port1 base address. confguration options: [disabled] [3f8/irq4] [2f8/irq3] [3e8/irq4] [2e8 /irq3] parallel . port . address . [378] allows you to select the parallel port base addresses. confguration opt ions: [disabled] [378] [278] [3bc] parallel . port . mode . [ecp] allows you to select the parallel port mode. confguration options: [norm al] [bi-directional] [epp] [ecp] ecp mode dma channel [dma3] appears only when the parallel port mode is set to [ecp]. this item allo ws you to set the parallel port ecp dma. confguration options: [dma0] [d ma1] [dma3] parallel port irq [irq7] allows you to select parallel port irq. confguration options: [irq5] [irq 7] asus v-series P5G43 5-25 the module v ersion and usb devices enabled items show the auto-detected values. if no usb device is detected, the item shows none . 5.4.5 usb confguration the items in this menu allows you to change the usb-related features. select an item then press 5-26 chapter 5: bios setup 5.4.6 . pci . pnp the pci pnp menu items allow you to change the advanced settings for pci/pnp devices. the menu includes setting irq and dma channel resources for either pci/pnp or legacy isa devices, and setting the memory size block for legacy isa devices. t ake caution when changing the settings of the pci pnp menu items. incorrect feld values can cause the system to malfunction. plug . and . play . o/s . [no] when set to [no], bios confgures all the devices in the system. when set to [yes] and if you install a plug and play operating system, the operating system confgures the plug and play devices not required for boot. confguration options: [no] [yes] select screen select item +- change option f1 general help f10 save and exit esc exit v02.58 (c)copyright 1985-2008, american megatrends, inc. bios setup utility advanced advanced pci/pnp settings warning: setting wrong values in below sections may cause system to malfunction. plug and play o/s [no] no: lets the bios confgure all the devices in the system. yes: lets the operating system confgure plug and play (pnp) devices not required for boot if your system has a plug and play operating system. asus v-series P5G43 5-27 5.5 power menu the power menu items allow you to change the settings for the advanced power management (apm). select an item then press 5-28 chapter 5: bios setup 5.5.4 apm confguration apm confguration restore on ac power loss [power off] resume on by ps/2 kb/mouse [disabled] resume on ring [disabled] resume on pci devices [disabled] resume on pcie devices [disabled] resume on rtc alarm [disabled] asus v-series P5G43 5-29 5.5.5 . hardware . monitor cpu . temperature . [xxxoc/xxxof] . or . [ignored] mb . temperature . [xxxoc/xxxof] . or . [ignored] the onboard hardware monitor automatically detects and displays the motherboard and cpu temperatures. select ignored if you do not wish to display the detected temperatures. cpu . fan . speed . (rpm) . [xxxxrpm] . or . [ignored] the onboard hardware monitor automatically detects and displays the cp u fan speed in rotations per minute (rpm). if the fan is not connected to th e motherboard, the feld shows n/a . select ignored if you do not wish to display the detected speed. cpu . q-fan . control . [disabled] allows you to enable or disable the q-fan control. confguration options : [disabled] [enabled] chassis . fan . speed . [ignored] . or . [n/a] the onboard hardware monitor automatically detects and displays the ch assis fan speed in rotations per minute (rpm). if the fan is not connected to th e motherboard, the feld shows n/a . select ignored if you do not wish to display the detected speed. chassis . q-fan . control . [disabled] allows you to enable or disable the chassis q-fan control. confguratio n options: [disabled] [enabled] v02.58 (c)copyright 1985-2006, american megatrends, inc. select screen select item +- change field f1 general help f10 save and exit esc exit cpu temperature v02.58 (c)copyright 1985-2008, american megatrends, inc. bios setup utility power hardware monitor cpu temperature [23oc/73of] mb temperature [30oc/86of] cpu fan speed [4891rpm] cpu q-fan control [disabled] chassis fan speed [n/a] chassis q-fan control [disabled] power fan speed [n/a] vcore voltage [1.344v] 3.3v voltage [3.152v] 5v voltage [4.838v] 12v voltage [11.712v] 5-30 chapter 5: bios setup 5.6 boot menu the boot menu items allow you to change the system boot options. selec t an item then press asus v-series P5G43 5-31 5.6.2 boot settings confguration select screen select item +- change option f1 general help f10 save and exit esc exit boot settings confguration quick boot [enabled] full screen logo [enabled] addon rom display mode [force bios] bootup num-lock [on] wait for f1 if error [enabled] hit del message display [enabled] allows bios to skip certain tests while booting. this will decrease the time needed to boot the system. set this item to enabled to use the asus mylogo2? feature. quick boot enabled enabling this item allows the bios to skip some power on self tests (post) while errwlqjwrghfuhdvhwkhwlphqhhghgwrerrwwkhvvwhp:khqvhwwr>'lv deohg ,26shuirupvdoowkh3267lwhpv&rqjxudwlrqrswlrqv>'lvdeohg>(qdeohg full screen logo enabled this allows you to enable or disable the full screen logo display feature. &rqjxudwlrqrswlrqv>'lvdeohg>(qdeohg addon rom display mode force bios allows you to set display mode for option rom. &rqjxudwlrqrswlrqv>)rufh,26>.hhs&xuuhqw bootup num-lock on oorzvrxwrvhohfwwkhsrzhurqvwdwhiruwkh1xp/rfn&rqjxudwlrqr swlrqv >2i i>2q wait for f1 if error enabled when set to enabled, the system waits for the f1 key to be pressed when error rffxuv&rqjxudwlrqrswlrqv>'lvdeohg>(qdeohg hit del message display enabled when set to enabled, the system displays the message press del to run setup gxulqj3267&rqjxudwlrqrswlrqv>'lvdeohg>(qdeohg 5-32 chapter 5: bios setup if you forget your bios password, you can clear it by erasing the cmos real time clock (rtc) ram. see section 4.6 jumpers for information on how to erase the rtc ram. 5.6.3 . security the security menu items allow you to change the system security settings. select an item then press asus v-series P5G43 5-33 user . access . level . [full . access] this item allows you to select the access restriction to the setup items. confguration options: [no access] [v iew only] [limited] [full access] no . access prevents user access to the setup utility . view . only allows access but does not allow change to any feld. limited allows changes only to selected felds, such as date and t ime. full . access allows viewing and changing all the felds in the setup utility. change . user . password select this item to set or change the user password. the user . password item on top of the screen shows the default not . installed . after you set a password, this item shows installed . t o set a user password: 1. select the change . user . password item and press 5-34 chapter 5: bios setup 5.7 tools menu the t ools menu items allow you to launch special functions. select an ite m then press asus v-series P5G43 5-35 5.7.2 . express . gate . [enabled] allows you to enable or disable the asus express gate feature. the asus express gate feature is a unique instant-on environment that provides q uick access to the internet browser and skype. confguration options: [enable d] [disabled] enter . os . timer . [10 . seconds] sets countdown duration that the system waits at the express gates frs t screen before starting windows or other installed os. choose [prompt . user] to stay at the frst screen of express gate for user action. confguration options: [prompt user] [1 second] [3 seconds] [5 seconds] [10 seconds] [15 seconds] [20 seconds] [30 seconds] reset . user . data . [no] allows you to clear express gates user data. confguration options: [no] [reset] when setting this item to [reset] , make sure to save the setting to the bios so that the user data will be cleared the next time you enter the express gate. user data includes the express gates settings as well as any personal information stored by the web browser (bookmarks, cookies, browsing history, etc.). this is useful in the rare case where corrupt settings prevent the express gate environment from launching properly. the frst time wizard will run again when you enter the express gate environment after clearing its settings. 5-36 chapter 5: bios setup 5.7.3 . ai . net . 2 select screen select item +- change option f1 general help f10 save and exit esc exit ai net 2 pair status length check realtek lan cable [disabled] check realtek lan cable during post. it will take 3 to 10 seconds to diagnose lan cable. check . realtek . lan . cable . [disabled] enables or disables checking of the realtek lan cable du ring the power-on self - t est (post). confguration options: [disabled] [enabled] asus v-series P5G43 5-37 5.8 exit menu pressing 5-38 chapter 5: bios setup |
Price & Availability of P5G43
![]() |
|
|
All Rights Reserved © IC-ON-LINE 2003 - 2022 |
[Add Bookmark] [Contact Us] [Link exchange] [Privacy policy] |
Mirror Sites : [www.datasheet.hk]
[www.maxim4u.com] [www.ic-on-line.cn]
[www.ic-on-line.com] [www.ic-on-line.net]
[www.alldatasheet.com.cn]
[www.gdcy.com]
[www.gdcy.net] |